PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000755899
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 402aa    MW: 43616.5 Da    PI: 8.2613
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000755899genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-16120165147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v q+G+ +W+ Ia+++  gR++k+c++rw++ 
    MDP0000755899 120 RGHWRPAEDSKLKELVGQYGPQNWNVIAEHLD-GRSGKSCRLRWFNQ 165
                      899*****************************.***********996 PP

2Myb_DNA-binding582.1e-18172215146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++eE+e+l+ a++++G++ W+ Iar ++ gRt++ +k++w+ 
    MDP0000755899 172 RGAFSEEEEERLLAAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 215
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.401115166IPR017930Myb domain
SuperFamilySSF466895.24E-28118213IPR009057Homeodomain-like
SMARTSM007171.4E-13119168IPR001005SANT/Myb domain
PfamPF002492.4E-15120165IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-26121173IPR009057Homeodomain-like
CDDcd001677.71E-13123164No hitNo description
PROSITE profilePS5129427.362167221IPR017930Myb domain
SMARTSM007171.5E-15171219IPR001005SANT/Myb domain
PfamPF002494.8E-15172214IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-21174219IPR009057Homeodomain-like
CDDcd001671.39E-7183214No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MAFRHLMSDC DGFTRYQDLN FLPPPPVSNQ LSLSNIFGGS STSAMGVVPF SPSSSQQTNK  60
PWSFQALENG GPKNISDLGV LSGVDQKRPT PLNLNLVGEE DDDEGRSPAG GRTSAKSCIR  120
GHWRPAEDSK LKELVGQYGP QNWNVIAEHL DGRSGKSCRL RWFNQLDPRI NRGAFSEEEE  180
ERLLAAHRLY GNKWAMIARL FPGRTDNAVK NHWHVIMARR HREQSNVFKR RKPSSPPPPS  240
PLPHVVANFP KNPSTSTEST VSISTINDDS TQSASTCTDL SLTPSNKPPP TFFSKFHPFH  300
RPQIIGSPMG PSSSDGGFNK MIGSNGNGFC KSTGPVRGVG AAAAAMKGVD NSGHQSDSEI  360
SGDESVTTTR TNLSLSGEDQ DLHHEKTTTI HFIDFLGVGT A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C7e-351192203104C-Myb DNA-Binding Domain
1msf_C7e-351192203104C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.170240.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008386891.10.0PREDICTED: transcription factor MYB122
TrEMBLM5VQV01e-164M5VQV0_PRUPE; Uncharacterized protein
STRINGPOPTR_0013s06320.11e-100(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.18e-66myb domain protein 105